PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000144.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CAMTA
Protein Properties Length: 1137aa    MW: 128149 Da    PI: 5.8455
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000144.1_g00026.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1181.31.1e-56521682118
                     CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYah 87 
                              l+ ++rwl++ ei++iL n++k++++ e++trp+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLK g+++vl+cyYah
  Itr_sc000144.1_g00026.1  52 LEAQHRWLRPAEICEILSNYQKFRIAPEPPTRPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKSGSIDVLHCYYAH 137
                              5679********************************************************************************** PP

                     CG-1  88 seenptfqrrcywlLeeelekivlvhylevk 118
                              +een++fqrr+ywlLee++++ivlvhy+evk
  Itr_sc000144.1_g00026.1 138 GEENENFQRRSYWLLEESQSNIVLVHYREVK 168
                              ****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.52847173IPR005559CG-1 DNA-binding domain
SMARTSM010763.8E-7850168IPR005559CG-1 DNA-binding domain
PfamPF038591.3E-4953166IPR005559CG-1 DNA-binding domain
SuperFamilySSF812965.77E-16544630IPR014756Immunoglobulin E-set
PROSITE profilePS5029718.961728839IPR020683Ankyrin repeat-containing domain
CDDcd002045.62E-15734837No hitNo description
SuperFamilySSF484038.08E-19736839IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.1E-19738842IPR020683Ankyrin repeat-containing domain
PfamPF127961.6E-8750840IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500889.618778810IPR002110Ankyrin repeat
SMARTSM002480.0015778807IPR002110Ankyrin repeat
SMARTSM00248160817846IPR002110Ankyrin repeat
SuperFamilySSF525402.23E-79491004IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001514953975IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.242954983IPR000048IQ motif, EF-hand binding site
PfamPF006120.026956974IPR000048IQ motif, EF-hand binding site
SMARTSM000150.011976998IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.9019771001IPR000048IQ motif, EF-hand binding site
PfamPF006122.0E-4981997IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1137 aa     Download sequence    Send to blast
MAAESRRQGL NAQLEWVKTF KLLTELLAYV IPADYLMAST SNLYANIEQI LLEAQHRWLR  60
PAEICEILSN YQKFRIAPEP PTRPPSGSLF LFDRKVLRYF RKDGHNWRKK KDGKTVKEAH  120
EKLKSGSIDV LHCYYAHGEE NENFQRRSYW LLEESQSNIV LVHYREVKYK GNRMNSSRAR  180
APQSAIPVFQ QSEEDGRSFS DVGSTVSSKL RPYDYQVTSH VTDTTSLNSG QASEYEDVES  240
VYNQQSTSGL HSFTELQSNM IPKAEDGLSA PYYPAPFSND QQGYYPAISG MDFPSITHGN  300
QNRNTANAYM PSRDLDFPSW ENVSEKNTAD YQSVQFQPSI SSAQSVAINT INGQGSAMIG  360
FTNDFSIKQE ADNHFHALEE WQASNDNSLQ SSEWSVDQKM EPHQTFDFAS KLDKEKHAEF  420
HDYLEAYNIL HTEPDKHPMQ NGRFVKAESD GSFNVDGKTD HLAFKQPLLG GVLRQGLTKL  480
DSFDRWISKE LEDVKEPNMQ SSSQSYWENV GNEDGVAESA IASQAQLDPY VLSPSLSQDQ  540
LFSIIDFSPT WAYAGTEIKV LITGRFLKSY QEVEKYNWAC MFGELEVPAE IIRDGVLRCH  600
TPFQKAGRVP FYITCSNRLA CSEVREFEFR VSEAQDGTSS GSSGGSSESL LHMRFVRMLS  660
LGSSSSLNSV PRNVDDISHI IRKINSLLQE DCEWENMMQL SSDDTFLREK TKDQLLQKLL  720
KDNLRNWLLQ KVSEGGKGAN VLDEAGQGVL HFAAALGYDW AVPPTLAAGV NVNFRDANGW  780
TALHWAAFYG RERMVGCLIS LGAAPGALTD PTPQHPSGRT PADLASSSGH KGIAGYLAES  840
ALSTHLSLLK LKENLEDESA EVSGLTAVQM ASERVATPVG DGDWPDGPSM KDSLAAVRNA  900
TQAAARIHQV YRVESFQRKQ IKEYGDGGEF GLPDERALSL RAVKNRAGHY DEPINAAAIR  960
IQNKFRSYKG RKEFLQIRQQ IIKIQAHVRG HQVRKNYGKI IWSVGILEKV ILRWRRKGSG  1020
LRGFKPETVT EPSIMQAQPV QEDEFDFLKE GRKQTEERLQ KALARVRSMV QYPEARDQYR  1080
RLLNVVSEMK ETKKKYDGDP SNSGEVGDFD EDLIDLGALL DDDTYMLDDF DVNQMKM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016452774.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X2
TrEMBLE5D5L10.0E5D5L1_SOLLC; Calmodulin-binding protein
STRINGVIT_07s0141g00250.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22302146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains